<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33071
| Description |
Uncharacterized protein |
| Sequence | MTTTQELAMEGERHLEETIEAAYQIISAMNDELCNPSLWSTSATASSTAQTTTTTTGSNGAALVSADAAAIDGAPHQSESGAGGSGGGSGNSALDEASLRYKNSVTSLRAVLAAIPNSLKTKAFETENGFGTPESEEEIEKLEEQALSLRKEIAKRNVHVKELIDKFRELIADISTWQSPCSV |
| Length | 183 |
| Position | Head |
| Organism | Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Eutremeae> Eutrema.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.380 |
| Instability index | 42.33 |
| Isoelectric point | 4.60 |
| Molecular weight | 19308.01 |
| Publications | PubMed=23518688
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33071
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.21| 23| 24| 38| 60| 1
---------------------------------------------------------------------------
38- 60 (40.21/16.51) LWSTSATASSTA..QTTTTTTGSNG
63- 87 (33.99/13.18) LVSADAAAIDGAphQSESGAGGSGG
---------------------------------------------------------------------------
|