<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33059
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MTETEEQQRIRFQVELEFVQCLANPNYLNFLAQRGYFKDQCFINYLKYLLYWKDSKYACFLKYPQCLHFLELLQYEHFRKELVNSQCSKFIDDQQLLHWQHYMRKRLDLLQAQADKHSQSVKPNT |
Length | 125 |
Position | Middle |
Organism | Lottia gigantea (Giant owl limpet) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Patellogastropoda> Lottioidea> Lottiidae> Lottia.
|
Aromaticity | 0.16 |
Grand average of hydropathy | -0.641 |
Instability index | 37.64 |
Isoelectric point | 8.25 |
Molecular weight | 15411.51 |
Publications | PubMed=23254933
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33059
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 54.07| 10| 17| 20| 31| 1
---------------------------------------------------------------------------
20- 31 (15.78/14.02) QCLAnpNYLNFL
40- 49 (20.73/10.56) QCFI..NYLKYL
65- 73 (17.55/ 8.07) QCL...HFLELL
---------------------------------------------------------------------------
|