<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33058
| Description |
Uncharacterized protein (Fragment) |
| Sequence | KCVEQLSAQEHFNSSDTTEESRVGIEQSVQKFIDLARETEYFFLNKRLVLSTQKPEQVLKEDIQELKNEIERKEKLIDKHHERLQNWQNRLHKIPGNGGPQPGGAGHPQQPQGPPPPHPSMMHQQPPPQFTVPGPPGHPGPPGQQPFVLPPPPSSSYPLAYLKQNLSNIGMGERR |
| Length | 175 |
| Position | Head |
| Organism | Lottia gigantea (Giant owl limpet) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Patellogastropoda> Lottioidea> Lottiidae> Lottia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.049 |
| Instability index | 71.72 |
| Isoelectric point | 7.27 |
| Molecular weight | 19715.97 |
| Publications | PubMed=23254933
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33058
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 105.35| 27| 34| 91| 120| 1
---------------------------------------------------------------------------
91- 120 (57.35/20.95) LHKIPgngGPQ...PGGAGHP....QQP.QGPPPPHPS
122- 156 (48.00/12.63) MHQQP...PPQftvPGPPGHPgppgQQPfVLPPPPSSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.90| 15| 15| 54| 68| 3
---------------------------------------------------------------------------
54- 68 (23.39/15.57) KPEQVLKEDIQELKN
72- 86 (24.51/16.62) RKEKLIDKHHERLQN
---------------------------------------------------------------------------
|