Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MAEPIRRPDQISPRSSPRDRGSRSPACPRPDSTGTLKTTISLGKNPSVKHTGPFYCLKDIPEQSEITGSTNLLHHYGLEHSYNKFCGKKVKEELSAFLPHLPGNIDIPGVQDNSSLRLLIEKPPIIGKELTQLSGLSLAGFRLHPGPLPEQYRMLHQLPSKKKKHKKHKKEGEKTNALSEAQSKFK |
Length | 186 |
Position | Head |
Organism | Lottia gigantea (Giant owl limpet) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda> Patellogastropoda> Lottioidea> Lottiidae> Lottia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.825 |
Instability index | 59.70 |
Isoelectric point | 9.78 |
Molecular weight | 20727.60 |
Publications | PubMed=23254933 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33052 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.24| 15| 27| 49| 63| 1 --------------------------------------------------------------------------- 49- 63 (29.07/18.30) KHTGPFYCLKDIPEQ 79- 93 (27.17/16.72) EHSYNKFCGKKVKEE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IRRPDQI 2) MLHQLPSKKKKHKKHKKEGEKT | 5 154 | 11 175 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab