<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33045
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MQKEEKLLETSLPDIIAKVAEIKNAIASFLFKLENEYATLNWPSMLDNFALISSNMNSLSKVLKGERIPPLRNFTLFPVLLSPERDQELEKLTEGRLFMCNHEVVPDYLRTKPETDVEEKINQLNTKAGTIPSDNAQKQLNNLNKITSNILDIINSYKEEWDNESKQKTQQPQTSSQAETNTLIAAISMGKGLRLQSQISQQQMQQQMPNMQPGQKPMSVGKVPSTVKTTIRAGSHPYQRS |
Length | 241 |
Position | Head |
Organism | Lottia gigantea (Giant owl limpet) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Patellogastropoda> Lottioidea> Lottiidae> Lottia.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.640 |
Instability index | 42.36 |
Isoelectric point | 7.76 |
Molecular weight | 27273.82 |
Publications | PubMed=23254933
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33045
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.61| 23| 32| 165| 191| 2
---------------------------------------------------------------------------
165- 191 (33.52/22.95) SKQKTQQPQTSSQAETNTLiaaiSMGK
200- 222 (44.09/22.12) SQQQMQQQMPNMQPGQKPM....SVGK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 29.50| 9| 27| 83| 92| 3
---------------------------------------------------------------------------
83- 92 (12.77/11.14) PERDQElEKL
113- 121 (16.73/ 9.38) PETDVE.EKI
---------------------------------------------------------------------------
|