<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33038

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMPPVDMAGAPGPQSGGGSIPLATLIDYSLQRTHHELIVLSELLPRKTDMERKIEIFQFASRTRQLFVRLLALVKWATSATKVDKCTEICNFLEQQSMFFVDTADSLARLARDTLSNARLPSFSLPSAIDVLTTGTYPRLPTCIREKIVPPDPITPQEKKETLHRLDQVIQYRLVSTDLPPQMRKLNIAQGRVKFTVDHEFEVTLTLMGDSPTIPWRLLDIDILVEDHETGDGKSLVHPLQVNYIHKLVQTRLLDNDKPLHDLYRVLHSFSQALQLEVLNSQTQRLIRARLGDNVRVEEYTLSRRLLISYWRELSKNCKNADPVIYKLSVHVCESDDGKPLQITHFPPMSPAECTKVGLAIKSDQLSIEKLLMQTIEVRTHAKLRELSKEMQRYVSNKCEIRDMPAALHTPVLNPCMPSEVLRIAIDVLRGTYITSVPAYDNPCIKDVEDCFNNDKRGLDKVITKLRLQLNLLRCEKSVQMLLAPCFHSLPIVNMSGHALENLSKSKLFIGVPRQTSYYVIVELHEKINNSIDFKYYFLHTKPCTADGNEDTGSDSTVKSFLKADKFLEIHINSVIKDSLSRKRKLLGEGDEPDIKKVKGSPYFIPELTYLLASAEEKIPFVHLGEELERQNISHEGIQIDGEGVCMALGILEFPNCMGVSEETNKAIKDKLLSCKFHILSRIRSWNVEFIFDQSPLESEYYKESGDIQKVFLNLDLNNDNYKKTVIDLLREWNAIGNLYSLVKDFADIYSDPKSNFQSTIKIKSYNYKKLVLAYGPKFLYLVTIQWKGEDNLFHISLGTNGQCATGNPHVVVSNHLQKDLNSSRNLAFLLQILLDTLSPMISMAHLNTVPVIGTSQTPKLSSLSFIVIPQSSTHLRIIFRNFNCIDVNIRGNKLVAVRDGSYSHFDNSTVVEALTPTPGLKTFLNMFVDDAALGGRSRRRSTTEDDNPPSPMDTVDIFSQPNTGSPATRPPKQDLTSNFRFQNPMTPPSNPHTPASPGAARMPSGINPSPSTALMGTPSPSTLLTGESPSNPHLHVPSPGSLIAAPSPGSIGMHMHSPAASFMSPSGMVEGGSPYPGSNLANPSPRNWPGSPSVMGSGPSPASYHGATASPGHPALHSPQTAQSQVLSPPSRILPRKSWAASIPTLLSHDAFDKLLTPVVIPGSSPVLLSPLERFLGCNFLKRHLNRLIHQEQALTVIPSPSEPGVLIFKAESLQYMVNIIMNTSDLQTLNLKVSPVPEFTDQWTTEETQIIERYFDVKVACYPYKLNTMFAFAKILSAPLRILKDFVQIMRLELMPDPNMKWSIQWCLTIPHDTPLSPPPGTPCVIVKSKVVIVIQLTRIGLNLPPGKEAQSINIPLVFVDQYNTVSMFNFDRGQNSQIAMSIMVMLKRFTEMHQNPAECALFPAIRELMTNLVLPM
Length1418
PositionTail
OrganismLottia gigantea (Giant owl limpet)
KingdomMetazoa
LineageEukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda> Patellogastropoda> Lottioidea> Lottiidae> Lottia.
Aromaticity0.07
Grand average of hydropathy-0.192
Instability index48.28
Isoelectric point7.91
Molecular weight158354.90
Publications
PubMed=23254933

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33038
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     200.08|      31|      34|    1071|    1101|       1
---------------------------------------------------------------------------
  916-  951 (28.09/ 8.87)	...........PTPGlktfLNMfvddAAL...GGRSRRRSTTEDDNPP.....S...P
 1026- 1065 (37.97/14.68)	GESpsnphlhvPSPG....SLI....AAP...S....PGSIGMHMHSPaasfmS...P
 1071- 1101 (65.46/30.88)	GGS........PYPG....SNL....ANP...SPRNWPGSPSVMGSGP.....S...P
 1106- 1135 (38.94/15.26)	GAT........ASPG.....HP....ALH...SPQT...AQSQVLSPP.....SrilP
 1141- 1171 (29.63/ 9.78)	ASI........PTLL....SHD....AFDkllTPVVIPGSSPVLLS.P..........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.16|      32|      34|      36|      67|       2
---------------------------------------------------------------------------
   36-   67 (51.57/37.81)	LIVLSELLPRKTDMERKIEIFQFASRTRQLFV
   69-  100 (54.60/40.51)	LLALVKWATSATKVDKCTEICNFLEQQSMFFV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     165.27|      39|      41|     421|     459|       4
---------------------------------------------------------------------------
  421-  459 (68.60/47.02)	LRIAIDVLRGT.YITSVPAYD..NPCIKDVEDCF.........NNDKRGLD
  465-  500 (56.68/37.41)	LRLQLNLLRCE...KSVQMLL..APCFHSL.PIV.........NMSGHALE
  506-  554 (39.99/23.96)	.KLFIGVPRQTsYYVIVELHEkiNNSI.DFKYYFlhtkpctadGNEDTGSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.98|      24|      28|     135|     159|       6
---------------------------------------------------------------------------
  135-  159 (40.90/25.21)	TYPRLPTCIREKIVPPDpITPQEKK
  161-  184 (43.07/21.94)	TLHRLDQVIQYRLVSTD.LPPQMRK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.70|      13|      28|     834|     846|       7
---------------------------------------------------------------------------
  834-  846 (23.94/14.72)	LDTLSPMI...SMAHL
  860-  875 (16.76/ 7.98)	LSSLSFIVipqSSTHL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.60|      11|      34|     961|     971|       8
---------------------------------------------------------------------------
  961-  971 (22.58/12.10)	PNTGSPATRPP
 1010- 1020 (19.02/ 8.86)	PSTALMGTPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.91|      18|      18|     686|     703|       9
---------------------------------------------------------------------------
  686-  703 (30.98/18.39)	NVEFIFDQSPLESEYYKE
  706-  723 (29.94/17.53)	DIQKVFLNLDLNNDNYKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.39|      24|      34|     294|     317|      10
---------------------------------------------------------------------------
  294-  317 (41.96/25.11)	VRVEEYTLSRRLLISYWRELS.KNC
  329-  353 (41.43/24.71)	VHVCESDDGKPLQITHFPPMSpAEC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.86|      12|      22|     749|     761|      11
---------------------------------------------------------------------------
  749-  761 (16.60/13.42)	YSdPKSNFQSTIK
  774-  785 (21.26/12.05)	YG.PKFLYLVTIQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.40|      10|     505|     220|     237|      12
---------------------------------------------------------------------------
  197-  213 (13.42/ 9.18)	DHEfevtltlMGDSPTI
  226-  235 (18.98/ 8.77)	DHE.......TGDGKSL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33038 with Med14 domain of Kingdom Metazoa
Unable to open file!