<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33033
| Description |
Uncharacterized protein (Fragment) |
| Sequence | LGISWHDTAWIPILNQNNVMDYFSERSNPFYDRMCNNEMIKMQRLNPDQLQNMVGVEYVLLHVQEPILYVIRKLHRHSPTQVTPLAHYYIIAGRVYQAPDLCSVLNSRLLNSVSSLQSAFDEASSYSKYTPSKGYIWQFKDKEEKDQKEKKKKELPSSSFQRSRVDLLLGELGKKFPPPTIALAQSDPVAVNKGMTFILNEH |
| Length | 202 |
| Position | Head |
| Organism | Lottia gigantea (Giant owl limpet) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Gastropoda>
Patellogastropoda> Lottioidea> Lottiidae> Lottia.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.487 |
| Instability index | 45.45 |
| Isoelectric point | 8.75 |
| Molecular weight | 23333.45 |
| Publications | PubMed=23254933
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33033
No repeats found
No repeats found
|