Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MDVSDLHPPDDYSHRFFIWHEWIQANGPLTTENVFEYFTTSMFYDKQSNNQVLRMQTIHTGMPVVNEAEELKRFTGVEFALVHSQPPSLFIIHKRERLSPEEVKPLAAYFIMNNRIYQAPDVYTVLSNRLLTSIYSIQTSLETLRTHRPDYTPRTGFVWPIIDPSLADDGNKKQDELSQIDETEESSASKAKATNASGTQKKQQNNMLLMNAMRATAAHSKSALSSSALARSAESVPMDTSAIAATNRSSSTPGPAASVASRGTTPKPPFESSSKVVPGAGKKKRKRTILANSPESSS |
Length | 298 |
Position | Head |
Organism | Moniliophthora roreri (strain MCA 2997) (Cocoa frosty pod rot fungus) (Crinipellis roreri) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Marasmiaceae> Moniliophthora. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.555 |
Instability index | 47.57 |
Isoelectric point | 8.64 |
Molecular weight | 33037.71 |
Publications | PubMed=24571091 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33030 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 34.71| 10| 27| 167| 176| 2 --------------------------------------------------------------------------- 167- 176 (17.51/12.26) ADDGNKKQDE 196- 205 (17.20/11.94) ASGTQKKQQN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FVWPII 2) PPFESSSKVVPGAGKKKRKRTILANSPESS | 157 268 | 162 297 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab