<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33025
Description |
Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MQDSSHWKQTELSLERPYKNDNGELLPTLFDITADGELIYEPKESSAQILGDNLYRIFAERGADFFEQNPPGFLEIGILQTSEPKAETAVEDEGENNEEETGESKLMTVEELFKMRMEIMPQLYIALGELSHARDLLSLILSSANPNPGSETNMGPSTLSATVVTKPPSIIPLQAFNAQLAIGSKDEALRRASDIFKTAADRMERTRLRNERYWVDALKIRRGNWGLTPAPLPLGAPTGKGADKTTKDFVISYGLEESPPAFRRRAVAQMSYTGPDNLVFPHRQNTRLRIGVTSTRADGSRVVAYNNTSESIAHEESLGILKTAQREVIEQEIFAQIGKEAGTLPTASARVSERLIHIDAAQNTELTFELIDNKASISEAVDSIDQAKCDFIYYYLLALLLRRHAYHKQRRLGSGSAGSLMQKTTQGQSEAAPAILEPVIHLLQYQVFTRRVNIELNTACTALNKAGIQTTLRFNAVEEIGKELVNLVANQDIENMTVGGEAVLRVDGRYTIRLTMGSPSTLTAHLSQATINILSIPELCKLLKDEIEKIVLERICGLGRQICGDLGAIWFVDMNRCVGRWDGCVLNFCVEEEEQLEFSCVASRFGRKGKEPSLVETYNMSSNTPILAWAKDVISQSL |
Length | 638 |
Position | Head |
Organism | Moniliophthora roreri (strain MCA 2997) (Cocoa frosty pod rot fungus) (Crinipellis roreri) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Marasmiaceae> Moniliophthora.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.286 |
Instability index | 48.91 |
Isoelectric point | 5.21 |
Molecular weight | 70788.55 |
Publications | PubMed=24571091
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33025
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 230.46| 73| 260| 17| 92| 2
---------------------------------------------------------------------------
17- 92 (112.94/87.50) PYKnDNGELLPTLFDITADGELIYEPKESSAQILGDNLYRIFAERGADFFEQNPpgFLEIGILQTSEPKAETAVED
281- 353 (117.52/79.10) PHR.QNTRLRIGVTSTRADGSRVVAYNNTSESIAHEESLGILKTAQREVIEQEI..FAQIGKEAGTLPTASARVSE
---------------------------------------------------------------------------
|