<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33020

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMNPEPSTSMVAAPSPQNTLSNGAYENGTLEPSMEELERELPIVLDGQVPLGELLSRVMQTVFAELSEMAETLPNSSDTARKRMLADWVVKTKKQIVKLYAIAKWSRDADTVQKCMNITAFLMDQNRQFEDAIVGLNYARESLDPARLRNHDLLTSLDVLTTGSYRRLPTAIKKSIIPPTPLTDAQVLKTLRDIQDVIRYRLRLREIIPIEMSRHRIADGCVYFTAPKLFEVSIRLTGAQPHDRWLFVHVDFLLNIGGDMTGTQDFPRTPSGIMKKFISEEVDRQLGMYIPGPAPQEQLPPGVVHPIKPELPDDVADAPLVRLFNFLQMMALSYQLEILWYQAERMRSLGWGDYLTVSMSPNRKVMSVSYWVRQPPPQVPGRQQSKLPLLGGTVTISIIDCSTSFSSVKRSSRALALAELQQKAKLGAMRPSDVVEGLKFEVRWEPTAGALGVNVSAQDCVLPEGTLMVNHDNLDFELMLRKVIHQHARAVLARYQLQLQHTSVPRSVFAGPGVVILVDNKEILALRVVLCADKVITISIDARTGRFIFRDVGDLSPGGQAPKYAVIFEKVNEAPALMLRMLSNLRVETLIELVEQKANYLGLQSYRRRNFLPEEMQKLGTGAQGTLYIQLRSYPPYYLVIVIFLDEFRYALITTELLPESPCANLVMKDIAWLDFNRIHNEEVTIIEPSAQKIGFKRKLPEGDDGDAPSRASFQLETQVLRELYNYCCARVAYMNVERQLKLRNIPFTHVNPASGHPVTPELAHIQSSLARSVPALCVQSKHILEGAPAAEAAMPNIRVIPLNWWSEKNAQVVTCVKLKYVQQPMGKTAGTSAVIRPSKRIIYDTTEAVVSFLSENVNTCVDEFLEEWARVSKMVVIAREVAQMSKTKDKKDISLLSFDLQTVEFAYAEDYTVSITTSEDRSSITGAKFDLRFSRIRSTRRGLTPDSDEWFNPHDDAEPFLRDVLRQGHGRLAPSLHRLVDILRDTLSIVTGLEEIRKESEKEENNLPVDTFAKSAGWYRLIYGDLRHGLDFRLLSNQRVAILDASHSLFNGSSSSIRGSTDSVMSNPNDLPNLGLQPIPDFSAVINESVLEAIAAEEAFSGKLAAIEWGVVTDKAAVKSIMKRIHRKVWSKLYSSS
Length1137
PositionTail
OrganismMoniliophthora roreri (strain MCA 2997) (Cocoa frosty pod rot fungus) (Crinipellis roreri)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Marasmiaceae> Moniliophthora.
Aromaticity0.07
Grand average of hydropathy-0.177
Instability index48.08
Isoelectric point6.88
Molecular weight127622.39
Publications
PubMed=24571091

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP33020
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     446.04|     182|     453|     142|     385|       1
---------------------------------------------------------------------------
  142-  207 (48.55/56.04)	...............................................................................................................................................................................................................................LDPARLRNHDLLTSL...DVLTTGSY..RRLPTAikkSIIPPTPLTDAQVLK..TLRDIQDVIRYRLRLREII
  230-  483 (248.92/253.97)	EVSIRLTGAQphdrwlfvhvdfllNIG.......GDmTGtqDFPRTPSGIMKKFISEE.............VDRQLGMyipGPAPQEQLPPGVVHPIKPELPDdvADAPLVRlfnflqmmalsyQLEILWYQAERMrsLGWGDYLTVSMsPNRKVMSVSYW...............VRQPPPQVPGR....QQSKlpllggtvtisiidcstsfssvkrssraLALAELQQKAKLGAMrpsDVVEGLKFevRWEPTA...GALGVNVSAQDCVLPegTLMVNHDNLDFELMLRKVI
  682-  839 (148.57/93.35)	EVTIIEPSAQ..............KIGfkrklpeGD.DG..DAPSRASFQLETQVLRElynyccarvaymnVERQLKL...RNIPFTHVNPASGHPVTPELAH..IQSSLAR............SVPALCVQSKHI..LEGAPAAEAAM.PNIRVIPLNWWseknaqvvtcvklkyVQQPMGKTAGTsaviRPSK.....................................................................................................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      92.13|      28|     453|     560|     589|       2
---------------------------------------------------------------------------
  560-  589 (43.93/30.39)	APKYAVIFEKVNEapALMLRMLSNLRVETL
 1016- 1043 (48.21/27.21)	AGWYRLIYGDLRH..GLDFRLLSNQRVAIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.39|      22|      35|      77|      98|       3
---------------------------------------------------------------------------
   77-   98 (37.60/27.14)	DTARKRM.....LADWVVKTKKQIVKL
  109-  135 (33.79/23.61)	DTVQKCMnitafLMDQNRQFEDAIVGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.70|      14|      30|     888|     901|       4
---------------------------------------------------------------------------
  888-  901 (23.05/14.17)	KDKKDISLLSFDLQ
  919-  932 (23.65/14.72)	EDRSSITGAKFDLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.37|      14|      35|      28|      41|       5
---------------------------------------------------------------------------
   28-   41 (23.65/13.70)	TLEPSMEELERELP
   60-   73 (22.72/12.88)	TVFAELSEMAETLP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33020 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MNPEPSTSMVAAPSPQNTLSNGAYENGTLEP
1
31










Molecular Recognition Features






MoRF SequenceStartStop




1) IHRKVWSKLYS
1125
1135