<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33011
Description |
Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MQNPLSYEKEEPLEVATSINMDRLTQLQDAIDEMARMFANSVEFLNRVQVGQDQIKLKENQQEIVQDVVKKAKQIEILIDNLPGLRNTEQEQFDMIKELNKEMQEANLEYIKAVEDAESLRKQIVETIEILCRDQSTAYNTEE |
Length | 143 |
Position | Middle |
Organism | Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) (Arbuscular mycorrhizal fungus) (Glomus intraradices) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina>
Glomeromycetes> Glomerales> Glomeraceae> Rhizophagus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.675 |
Instability index | 52.61 |
Isoelectric point | 4.43 |
Molecular weight | 16676.64 |
Publications | PubMed=30271968
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33011
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.40| 26| 52| 65| 90| 2
---------------------------------------------------------------------------
65- 90 (43.53/31.09) VQDVVKKAKQ....IEILIDNLPGLRNTEQ
114- 143 (38.87/27.11) VEDAESLRKQivetIEILCRDQSTAYNTEE
---------------------------------------------------------------------------
|