<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33007
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHELFLTAVVPDTDIERAKALLQGLSGMTARGTVHRILYFAGPPQPRGLAVKRAIPQPIQPAQGRLWTELHQQMVRQSFVLQARYPVNRDELGAAPGPATSPGAAAILSGAAQGTLRWTDIPDPTGGSSATGITRLVTQRKKVELPETRNLPAILTDNGYRFKSELIEESFIFYSNGNEYVLARYHRLPSAAPAAPGTPLTPLAALPSWDQITNSAGVDPSRQWLFFVRRHVVDDTSPDKMKKALEALEAARAQLTGIFAFVPVDRRAHDTRIERPAGGGNVGLPGAQAQKLRT |
Length | 294 |
Position | Head |
Organism | Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) (Rose-picker's disease fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Sporothrix.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.287 |
Instability index | 48.78 |
Isoelectric point | 9.92 |
Molecular weight | 31947.07 |
Publications | PubMed=24855299
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33007
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 128.73| 44| 98| 53| 105| 1
---------------------------------------------------------------------------
61- 105 (79.48/64.62) PAQGRL.WTELHQ.........................................QMVRQSF.........VLqARYPVNRDELGAAPGPATSPGAA
111- 205 (49.26/22.42) AAQGTLrWTDIPDptggssatgitrlvtqrkkvelpetrnlpailtdngyrfksELIEESFifysngneyVL.ARYHRLPSAAPAAPGTPLTPLAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.62| 20| 256| 12| 31| 2
---------------------------------------------------------------------------
12- 31 (35.04/21.85) DTDIER.AKALLQGLSGMTAR
270- 290 (32.58/19.84) DTRIERpAGGGNVGLPGAQAQ
---------------------------------------------------------------------------
|