Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MASQEDPSGAVAPYPQPPSYLWSQFTEENEAAIQELRETHAAATGEQTTAATIVPDVPEALAALQPPEPPPNGRWRVFGQMYTLNNQLPSLEEQGVARLGAALPTASAEKDAHASKVFELKKLAKSLLLNFLELAGILAIHPADAADKLADLQTIFFNMHQHINEWRPHQTREALISMLQAQLERTRNETRALHEVTDSVRKTLVGLADVEDPLAKNGAEARPRSQQAKTDSLLAPAARTAAETERRRQEDAWAALDETFG |
Length | 261 |
Position | Middle |
Organism | Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) (Rose-picker's disease fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Sporothrix. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.482 |
Instability index | 52.77 |
Isoelectric point | 5.08 |
Molecular weight | 28635.72 |
Publications | PubMed=24855299 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33006 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 155.42| 47| 61| 7| 54| 1 --------------------------------------------------------------------------- 7- 54 (75.44/38.50) PSGAVAPYPQPPSyLWSQFTEENEAAIQELRETHAAATGEQTTAATIV 71- 117 (79.98/37.19) PNGRWRVFGQMYT.LNNQLPSLEEQGVARLGAALPTASAEKDAHASKV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KTDSLLAPAAR 2) YPQPPSYLWSQFT | 229 14 | 239 26 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab