<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33003
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASAFGNNEPPSLPTAANGATTDVLQTRFEIECEFVACLANPYYLQHLAAEKYLDDPRFVRYLAYLQYWRTPPYLQYLSWPGPSLRHLELLQEESFRQAIISPEVVMRLEQEGIQAGFRWA |
| Length | 121 |
| Position | Middle |
| Organism | Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) (Rose-picker's disease fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Sporothrix.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.262 |
| Instability index | 63.89 |
| Isoelectric point | 4.92 |
| Molecular weight | 13986.70 |
| Publications | PubMed=24855299
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | DNA repair GO:0006281 IEA:EnsemblFungi
meiotic gene conversion GO:0006311 IEA:EnsemblFungi
meiotic sister chromatid segregation GO:0045144 IEA:EnsemblFungi
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP33003
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.56| 19| 20| 81| 99| 1
---------------------------------------------------------------------------
57- 77 (15.17/ 6.18) ..PRfVR.YLAYLQywrTPPYLQY
81- 99 (33.48/21.38) PGPS.LR.HLELLQ...EESFRQA
103- 121 (26.91/15.93) PEVV.MRlEQEGIQ....AGFRWA
---------------------------------------------------------------------------
|