Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSFHPQTPQSPSQFSPITSDPLSGTSNASVGTTTNSINTNVHGGSFSSTSASAATPSTLPTPAHSVNGSGSGFGSGFGPADAVHGMSPGGADSPYKRKRPLDDAGDLGHGSKKVHMEGQQRLDFEALHQDVGEKYLVCNKPHRPSFPPLSEDLFEMFNLTSIAAEVARTLPNGEKNAMRKTYKGYMKKLGVSGHFEPLKRDEGDESDFMRLISEADDSWQARQVKTKDIHYGLLDDVEADLRQAMTMNKGPIPKAIWDSSVLGDLAPEKLVSIGARPSSVRGTAPNTPLHPAVARSKVQPPLSAATGGAGSTGSLDTSRPRRVNKKRSYGENSFEGYGEGFPDDDGGDGGYSTGDGDGPSHKRRKKNGTPTAQYNSAPVRQQSYGPGMVGA |
Length | 391 |
Position | Head |
Organism | Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) (Rose-picker's disease fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Sporothrix. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.743 |
Instability index | 43.23 |
Isoelectric point | 7.22 |
Molecular weight | 41373.18 |
Publications | PubMed=24855299 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32998 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 344.63| 90| 150| 139| 232| 1 --------------------------------------------------------------------------- 8- 118 (122.36/50.05) PQSPSqFSPITSD....plsgtsnasvgtttnsintnvhggsFSSTSASAATPSTLPTPA.HSVNGSGSGFGSGF....GPADAVHGMS.PGGADSPYKR.KRPLDDAGDLGH.GSKKVHMeG 141- 232 (145.92/71.38) PHRPS.FPPLSEDLFEM.........................FNLTSIAAEVARTLPNGEKNAMRKTYKGYMKKL....GVSGHFEPLKRDEGDESDFMRlISEADDSWQARQvKTKDIHY.G 300- 363 (76.35/29.46) .......PPLSAATGGA.........................GSTGSLDTSRPRRV.NKKRSYGENSFEGYGEGFpdddGGDG...GYSTGDGDGPSHKR....................... --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DFMRLI 2) GYSTGDGDGPSHKRRKKN 3) PYKRKRPLD 4) QYNSAPVR | 207 350 94 373 | 212 367 102 380 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab