<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32997
| Description |
Uncharacterized protein |
| Sequence | MAETKTADSLSQVQDAVDQLAHQFLACLYFLERHHNLEKLGPTDIIQEQQKTESQPRTLTVEAIPTDEFRQGQEELARDLVYKEQQIEYLIGSLPGLENTEQDQERLIRELEEELKVAEVQRKEAVRERDEMLAKLDGVIRSIKRP |
| Length | 146 |
| Position | Middle |
| Organism | Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) (Rose-picker's disease fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Sporothrix.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.761 |
| Instability index | 51.44 |
| Isoelectric point | 4.73 |
| Molecular weight | 16956.84 |
| Publications | PubMed=24855299
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32997
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.37| 15| 16| 108| 122| 1
---------------------------------------------------------------------------
108- 122 (24.10/13.41) IRELEEEL.KVAEVQR
126- 141 (21.27/11.16) VRERDEMLaKLDGVIR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.07| 16| 20| 42| 59| 2
---------------------------------------------------------------------------
42- 59 (24.37/19.27) PTDiiQEQQKTESQPRTL
65- 80 (28.70/16.34) PTD..EFRQGQEELARDL
---------------------------------------------------------------------------
|