Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAPIGHSATAQAETAIRDTIQSLYNVMLHTSAYDAAGSHTSLDALVAEVRILSQALRDVNEVVENDNNGSGPNSVVTLDSTGTGHRSLPSVPRDLVQYVEAGRNPDIYTREFVELVRRTNQLRAGKRGAFAQFRDTLAGQIRSALPELGGDVDRVMGATVEHPSQADERGEPHTAPGSAQPAASLDGSSKTTLVGEAETPGSHGGSALVVTATAAPTGTTATQTTANVPASASASASPLAHPGSGGSNQAGAGTPSANSDAGSGTGSGGPHGVSSAPTTIDMMGILPSTPQPTSAAGGGTASGSGSSAAVGGGAAGSGGDGGQDAMETS |
Length | 329 |
Position | Middle |
Organism | Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) (Rose-picker's disease fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Sporothrix. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.306 |
Instability index | 28.69 |
Isoelectric point | 4.91 |
Molecular weight | 32360.67 |
Publications | PubMed=24855299 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32996 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 5| 209.46| 39| 40| 175| 213| 1 --------------------------------------------------------------------------- 131- 159 (34.18/ 9.24) .....A........QF..RDTLAGQIRSAL.......PELGGDVDRVMGAT 175- 213 (69.19/26.34) AP.GSA........QP..AASLDGSSKTTLV.GEAETPGSHGGSALVVTAT 215- 239 (29.92/ 7.17) APtGTT........A..........TQTT.....ANVPASASASA...SPL 241- 281 (46.43/15.23) HP.GSGgsnqagagTP..SANSDAGSGT....G...SGGPHGVSSAPTTID 291- 322 (29.73/ 7.07) QP.TSA........AGggTASGSGSSAA..VgGGAAGSGGDGG........ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 102.66| 32| 33| 37| 69| 2 --------------------------------------------------------------------------- 37- 68 (52.10/37.15) G..SHTSLDALVAEVRILSQALRDVNEVVENDNN 71- 104 (50.55/30.48) GpnSVVTLDSTGTGHRSLPSVPRDLVQYVEAGRN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GSSAAVGGGAA 2) QDAMETS 3) TIDMMGIL | 305 323 279 | 315 329 286 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab