<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32993
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MSFKIDELQWSEPETANEMQGIHSNSVLYYFMRSPYFDKTSNNNTVYNQALHNHNMFPVLETRERFEDFLRSMSGVEYIVHQAPAEMAPGTGTGVWVIRKQLRRKRNDGQPDDLTVYADYFVVGYNIYQAPTLADVLSSRITSMAVALGKAFPAMNSMQTWSPAEGHYYETTGKAVAAAAAAGEDGLVENQALRDEPDDEDQGVEEDEEEDEEEDEEEDDEDDDSDEDAMDVDKTETTTRDKGAHDDADSEDDADDDMLDPRLAEESYAIHMMYGGEYMDEQPISGRPGDFHIALAGGGRSAVGGAAGAARGKATADAADATKDGTGSGKATPKDGKEAQKSGAATPKPKRRKSKGAAA |
| Length | 359 |
| Position | Head |
| Organism | Sporothrix schenckii (strain ATCC 58251 / de Perez 2211183) (Rose-picker's disease fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Sporothrix.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.861 |
| Instability index | 50.57 |
| Isoelectric point | 4.35 |
| Molecular weight | 39170.94 |
| Publications | PubMed=24855299
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32993
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 69.52| 14| 16| 312| 325| 2
---------------------------------------------------------------------------
173- 186 (23.47/10.12) GKAV.AAAAAAGEDG
312- 325 (26.14/11.96) GKAT.ADAADATKDG
329- 343 (19.91/ 7.66) GKATpKDGKEAQKSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.66| 22| 26| 210| 231| 3
---------------------------------------------------------------------------
210- 231 (39.69/18.57) EDEEEDE.EEDDED..DDSDEDAMD
236- 260 (30.97/12.93) ETTTRDKgAHDDADseDDADDDMLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.72| 16| 20| 270| 289| 7
---------------------------------------------------------------------------
270- 289 (26.79/23.19) IHMMYGGeymdEQPISGRPG
293- 308 (26.93/13.13) IALAGGG....RSAVGGAAG
---------------------------------------------------------------------------
|