<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32979
Description |
Uncharacterized protein |
Sequence | MQNLPYDESSHMDRLTQAANSVDDLIKIMYSTLSYLTRKANFKPLDPKFPVTQTIPDLDPPHVFQENTNELVADFIRKAKQLEYLIAVLPSTTTLSDLSDPSGTNAQFDPEFEQLEKEIQQSNKEYLEALQLAETLHAQIQASLKAALETRAIPVPPESVVS |
Length | 162 |
Position | Middle |
Organism | Microbotryum lychnidis-dioicae (strain p1A1 Lamole / MvSl-1064) (Anther smut fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Microbotryales> Microbotryaceae> Microbotryum.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.410 |
Instability index | 31.24 |
Isoelectric point | 4.58 |
Molecular weight | 18202.29 |
Publications | PubMed=26076695
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32979
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.77| 13| 39| 49| 61| 1
---------------------------------------------------------------------------
49- 61 (26.27/17.72) FPVTQTIPDLDPP
89- 101 (23.50/15.10) LPSTTTLSDLSDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.60| 22| 41| 64| 87| 2
---------------------------------------------------------------------------
64- 87 (31.17/29.09) FQENTNELVADFIRKAKqlEYLIA
108- 129 (37.43/27.39) FDPEFEQLEKEIQQSNK..EYLEA
---------------------------------------------------------------------------
|