<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32977
Description |
Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSALVGYAFSSEASSDHEEEMQQVSVQVQVDVPVSAQPPVGPAAPAPAPTPADAPLEQAAPTPSSAPPVVASEPPQAEKDVKDDQDGDQDDDEDEDHDDDDLTPEPDYSFASPPPPLLDTNGHGHAEDVEQEHEHKHEHEPPQDNNHDYEEQAKEPTKLKATTRIHELDIVQQDIAKLLHLAGCTLASLDPEPNPNLDLSNEKHTPIPEDKNERFDHFAQAYFTTLNDIQLSLRTSIRHLALSKPSLQALLDPNYASLLPTQALEPGQSSIAAGGIAHRSRINPLPLTKSIPKWTTRDAQATSAGGVEEDGSMRLSVAARGLQAEAWRDLARIASAAQDPMKE |
Length | 343 |
Position | Head |
Organism | Microbotryum lychnidis-dioicae (strain p1A1 Lamole / MvSl-1064) (Anther smut fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Microbotryales> Microbotryaceae> Microbotryum.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.760 |
Instability index | 50.64 |
Isoelectric point | 4.46 |
Molecular weight | 37145.10 |
Publications | PubMed=26076695
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32977
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 63.74| 12| 32| 33| 44| 1
---------------------------------------------------------------------------
33- 44 (23.41/ 9.55) PVSAQPPVGPAA
49- 60 (21.34/ 8.11) PTPADAPLEQAA
68- 77 (18.99/ 6.48) PVVASEP..PQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.68| 28| 49| 79| 106| 2
---------------------------------------------------------------------------
67- 105 (42.27/19.00) P.........pvvaseppqaeKDVKDDQDGDQDDD..EDEDHDDDDLTPE
106- 155 (33.41/13.71) PdysfaspppplldtnghghaEDVEQEHEHKHEHEppQDNNHDYEEQAKE
---------------------------------------------------------------------------
|