<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32974
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MTVDALGVSSPDAEHHHSARGHTMAGEGTRPTYAIEQTLEQLLQSLLEMGICASDVQESALSSTPGGVASGYPGGLMGRKVSQTMEQLTKLYSYSGTVQDVMIPLEVVNFVDQGKNPHMYTREFIERVAGENMYTNGMLSAVSDYRDILTSSLGDAFPELVNHIRASPHPAGRSAGEEGPQVKQENGTHAMDGNDAQLGSNHETGVKMEP |
| Length | 210 |
| Position | Middle |
| Organism | Microbotryum lychnidis-dioicae (strain p1A1 Lamole / MvSl-1064) (Anther smut fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Microbotryales> Microbotryaceae> Microbotryum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.451 |
| Instability index | 38.84 |
| Isoelectric point | 4.90 |
| Molecular weight | 22504.75 |
| Publications | PubMed=26076695
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32974
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 122.47| 37| 45| 6| 42| 1
---------------------------------------------------------------------------
6- 42 (66.05/40.22) LGVSSPDAEHH..HSARGHTMAG.EGTRPTYAIEQTLEQL
49- 88 (56.42/33.29) MGICASDVQESalSSTPGGVASGyPGGLMGRKVSQTMEQL
---------------------------------------------------------------------------
|