<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32969

Description Uncharacterized protein
SequenceMQQPQSQLPHLQCHENQLIPLLQSMNTQGSVPQMQQNNMSSLLHNSLSTLSGDSTSQSNMMNPIQPGSNLDSGQGNALSSLQQTRVGSVQQNLVSISQPTKVNTLSTQSGASMLQPNIPLQSNSNMIQHQHLKQQHEQQMLQTQQLKRLQQHQNLMQNQQMQQQQLHQQAPSPMPGDSDKPVSGISSLLNTGNIVHQPSVAQALAPSLAIGTPGISASPLLAEFTSPDGAHGGALTTVSGKSNVTEQSLECLIKAVKSLSPKALGASVGDIGSVVSMIDRIAGSAAGNGSRAAAGEDLVAMTGCHLLSFLSFLFFTCFSQDGNSRE
Length326
PositionTail
OrganismPopulus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
Aromaticity0.02
Grand average of hydropathy-0.353
Instability index57.38
Isoelectric point6.39
Molecular weight34555.43
Publications
PubMed=16973872

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32969
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.41|      15|      15|      72|      86|       1
---------------------------------------------------------------------------
   72-   86 (24.83/ 9.51)	SGQGNALSSLQQTRV
   88-  102 (24.58/ 9.36)	SVQQNLVSISQPTKV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.09|      15|     137|       1|      16|       2
---------------------------------------------------------------------------
    1-   16 (28.44/15.30)	MQQPQsQLPHLQCHEN
  140-  154 (28.65/11.66)	MLQTQ.QLKRLQQHQN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.12|      13|      30|     126|     138|       3
---------------------------------------------------------------------------
  126-  138 (25.43/11.33)	MIQHQHLKQQ..HEQ
  155-  169 (20.69/ 8.01)	LMQNQQMQQQqlHQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.16|      17|     138|      47|      66|       4
---------------------------------------------------------------------------
   47-   65 (26.99/18.81)	LSTLSGDSTSQSNMmnPIQ
  105-  121 (32.17/12.03)	LSTQSGASMLQPNI..PLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.10|      15|      15|     256|     270|       5
---------------------------------------------------------------------------
  256-  270 (23.81/17.50)	VKSLSPKALGASVGD
  274-  288 (24.29/18.01)	VVSMIDRIAGSAAGN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32969 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MQQPQSQLPHLQCHENQLIPLLQSMNTQGSVPQMQQNNMSSLLHNSLSTLSGDSTSQSNMMNPIQPGSNLDSGQGNALSSLQQTRV
2) SVQQNLVSISQPTKVNTLSTQSGASMLQPNIPLQSNSNMIQHQHLKQQHEQQMLQTQQLKRLQQHQNLMQNQQMQQQQLHQQAPSPMPGDSDKPVSGISSLL
1
88
86
189










Molecular Recognition Features






MoRF SequenceStartStop




NANANA