<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32962
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAATPLPPPNLAAPPTNMEANQSLPPPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTCNNEQLRMRSIHPLDISQLSKMTGIEYMLNEVMEPHLFVFRKQKRDGPEKVTPMLTYYILDGSIYQAPQLSNVFASRIARALHHISKAFTMAASKLEKIGYDTSKKYS |
Length | 174 |
Position | Head |
Organism | Amborella trichopoda |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Amborellales> Amborellaceae> Amborella.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.336 |
Instability index | 52.56 |
Isoelectric point | 7.77 |
Molecular weight | 19863.70 |
Publications | PubMed=24357323
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP32962
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.21| 15| 21| 141| 155| 3
---------------------------------------------------------------------------
141- 155 (24.55/16.35) ASRIARALHHISKAF
159- 173 (24.66/16.44) ASKLEKIGYDTSKKY
---------------------------------------------------------------------------
|