<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32958
Description |
Uncharacterized protein |
Sequence | MSVLDEPDPTPPCICRLKENKPKDFSICDDEEIEQLPPFEMIEDPACPAKRFLATKYNVDDISEKKIERLHKAFLPNVNGNWSLGTPRPEPAKVNDLYVNIVPNIYERLDKDVRPLDSFKKYSVSEDGGTSNISNSVIRTESENASDFNGSGANASDSVIKLEPQNPYQNADNSEKSDIRTEEQQVFREWYECIDRPSYNNEPLRILPYCILD |
Length | 213 |
Position | Unknown |
Organism | Dendroctonus ponderosae (Mountain pine beetle) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Curculionidae> Scolytinae> Dendroctonus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.805 |
Instability index | 59.52 |
Isoelectric point | 4.57 |
Molecular weight | 24319.77 |
Publications | PubMed=23537049
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32958
No repeats found
|