<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32958
| Description |
Uncharacterized protein |
| Sequence | MSVLDEPDPTPPCICRLKENKPKDFSICDDEEIEQLPPFEMIEDPACPAKRFLATKYNVDDISEKKIERLHKAFLPNVNGNWSLGTPRPEPAKVNDLYVNIVPNIYERLDKDVRPLDSFKKYSVSEDGGTSNISNSVIRTESENASDFNGSGANASDSVIKLEPQNPYQNADNSEKSDIRTEEQQVFREWYECIDRPSYNNEPLRILPYCILD |
| Length | 213 |
| Position | Unknown |
| Organism | Dendroctonus ponderosae (Mountain pine beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Curculionidae> Scolytinae> Dendroctonus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.805 |
| Instability index | 59.52 |
| Isoelectric point | 4.57 |
| Molecular weight | 24319.77 |
| Publications | PubMed=23537049
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32958
No repeats found
|