<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32955
| Description |
Uncharacterized protein (Fragment) |
| Sequence | STRLGKYVNEVRRKTSNEELRRRAKELVKKWRIMLIPEANGQIKTATQPGPIRATPNKGSPPLQCPSADSKIEIKWNCGRSRDFR |
| Length | 85 |
| Position | Unknown |
| Organism | Dendroctonus ponderosae (Mountain pine beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Curculionidae> Scolytinae> Dendroctonus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.034 |
| Instability index | 66.25 |
| Isoelectric point | 10.74 |
| Molecular weight | 9760.18 |
| Publications | PubMed=23537049
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32955
No repeats found
No repeats found
|