Description | Uncharacterized protein |
Sequence | MRQPCSVPNQPTGWRLLCPMVVIATGARTELSGIKWRKLTWSEPGGGSHGPGHGIHHVVPGEPLDDPVLRSYSRCLAADILCVWRRVSGCSGSARPPPDAFEPPPPPAQPPPLSLASAKELWIFWYGEEPDLNELVAPELNMTGKMIFF |
Length | 149 |
Position | Middle |
Organism | Dendroctonus ponderosae (Mountain pine beetle) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia> Curculionidae> Scolytinae> Dendroctonus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.219 |
Instability index | 51.24 |
Isoelectric point | 6.40 |
Molecular weight | 16286.62 |
Publications | PubMed=23537049 |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP32949 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 113.08| 30| 45| 36| 69| 1 --------------------------------------------------------------------------- 36- 69 (50.74/27.24) WRKLtwSEPGGGSHGPGHGIHHvvPGEPLDDPVL 84- 113 (62.34/24.07) WRRV..SGCSGSARPPPDAFEP..PPPPAQPPPL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IKWRKL 2) KELWIFWY | 34 119 | 39 126 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab