<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32948
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MMSKMKKLLEILTNPHQRMPLETLIKCEIVLEKIDFKSRDAQFKVDTPFPDLPAFHSLLDVVAQNLQSPVINHTLHRTFGPTLDALFGPEFKLVPPLKRAKLEEPTSDIPDVLQGEIARLDQRFKVSLDPNQQPGAKSIQLICWLDCKQLPCVPPISLTIPENYPKKSPTCHIASHEYNATTFLSDVQTALLARITKLPKNYSVSHLLDTWEMSVRQASAPNKSISISLRCLHTTCCTCMKNAAKYAHFHA |
| Length | 251 |
| Position | Tail |
| Organism | Dendroctonus ponderosae (Mountain pine beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Curculionidae> Scolytinae> Dendroctonus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.199 |
| Instability index | 44.05 |
| Isoelectric point | 8.68 |
| Molecular weight | 28305.75 |
| Publications | PubMed=23537049
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32948
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.93| 23| 79| 107| 129| 1
---------------------------------------------------------------------------
107- 129 (39.47/24.37) SDIPDVLQGEIARLDQRFKVS..LD
185- 209 (33.46/19.83) SDVQTALLARITKLPKNYSVShlLD
---------------------------------------------------------------------------
|