<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32942
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MEDSDYETKLDSLRRYIPFLKNMMIELEAKGNRQAQLTKIKSLHDMITDTRKKLKLETLIRCEQVLTNIYHKVNPQIKSSRPIDSTKECASTSKGPSRCDSSTFNRVSFTSSPSSTPRSPSPVRNIVLNKPVTIPTEKVETSAVR |
| Length | 145 |
| Position | Tail |
| Organism | Dendroctonus ponderosae (Mountain pine beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Curculionidae> Scolytinae> Dendroctonus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.687 |
| Instability index | 61.57 |
| Isoelectric point | 9.68 |
| Molecular weight | 16457.72 |
| Publications | PubMed=23537049
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32942
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.35| 13| 15| 85| 97| 1
---------------------------------------------------------------------------
85- 97 (23.30/15.31) STKECASTSKGPS
102- 114 (23.05/15.07) STFNRVSFTSSPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.53| 10| 27| 8| 17| 2
---------------------------------------------------------------------------
8- 17 (17.53/11.52) TKLDSLRRYI
38- 47 (17.99/11.97) TKIKSLHDMI
---------------------------------------------------------------------------
|