<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32938

Description Similar to Mediator of RNA polymerase II transcription subunit 12 acc. no. Q0CBX9
SequenceMMGATSLPDSRSHTVDPITAANDGTSSIHSVRPVEAMNTIIYNCPESKVTNSRRKKRIGFAGDQSSNSNNASAQFIQPSKVYNRTPYVTATIQPYTTRNMTNTRTKQINPTGTKSETAKGTSRRDKLKPYVLEPPPQSLRYPKNKCADVHPWKGNHQEDHVTDAQARNGQYDKLFVGKHNVLSTGLPSQSELVLTALQNEQGSARPPIIAAMKQRQGLRHLSSLFLTILDKRQSYSLVTAPSTFKPPPRVTLPDQKREAWLRDLANSTVPLRRLSRTIPHGLKGPALLDQCVAKNIPIARAVWFVRCVGANELRGLKRKGVGSLGVGGENKWIKEWTVQVVQFIEKAITPCNTISDDQWRIRVRYATRLVTHLYAENLVDRTIFLEWYLSFLESSSLDTLPLALILIPALLEDVLKQRRCSPRLIEVLLKQTEAVLANHVDQLLIPLIRRLSVIISNILLSHRESLISSIDATKLQKLLSLADTRIYEVDQCLQNVTLRASFFQGGSKPSEADPESPISDRRKAVEYLDSIGVNFASSPVLPVTIYQRLNSLLSSDDLVSVVFEWAVTSLRSGQYRVYLAVEIFKLADADNVDIQTTILELLGQMDVHRKVKKEDVFLLISELVRTRNFKLNSYLRWLVSSGGTSGRNYYDESCPYHVQLLAEIPMRRDMDLPIRSLRNNLLLRCGFDFTHEERSIGEIKQMLLQKGIFALTTPLQIQTDRYVSLERHEEERIRNSTRAAKTDLAQWVLDGFKQLISSRPYPLSLPITQIILIRDVLELLGNAPMLLEMILAISNVDDCEILTLVANTICYNLEVFSVLHTPANDLTQRLYLKYKYIYTHQLQTSKEFLISLLDLFTLAGLDGPIKNELSNHLSTYDQRHPRTLQPIGGCSPISEPLDDDIFDDNDLENNEEIDRLWNTGAKVDKQDLSRLFETTVSKLETSFEDTDNASHLLSASKGLLKLREFNPETFDDLSRRWISRMDNYSNRLPLFRAFSSMIASSCLKIETLVNVALQIHSQYKASSISALDAGLFLTHTLSLLLCADPFSTPLSAASSYSLKLKRTLFITRSHAALLNLFRVAFQMSTESGDPVLSTQLRTLLSAPTSLDTLHLIATHNLPMLQTEVITPLLKQKQYLPSLLMLIDYLLADPEGGGEADSHVQVARLLDLADDFSIRICKLKLQIILTQEAKDAKDGKMRNRNVNPGNAPGNTAGGGNTTITGNATGGGSNTIARALLRGFTLASPERRTICKDLLSVLDHHCAAEIRQDVEELFWDEENFLRTKNLGARLEVQMGEGTGDAIARAFLAVVEATGGATGGVGGGANVVSSANSSNLSSGANGASSGTGASGGGGGGIDTSPPLLDHLNRFLLHLTPSPSSPTPSHDDPLPPPNSEPGSPSSLASSPYTDPPSYPGTHPATKRGYWLGYVRC
Length1428
PositionKinase
OrganismPyronema omphalodes (strain CBS 100304) (Pyronema confluens)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes> Pezizales> Pyronemataceae> Pyronema.
Aromaticity0.06
Grand average of hydropathy-0.239
Instability index42.49
Isoelectric point8.23
Molecular weight158256.64
Publications
PubMed=24068976

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32938
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.71|      12|      16|    1385|    1396|       1
---------------------------------------------------------------------------
 1385- 1396 (26.92/12.64)	PLPPPNSEPGS.P
 1403- 1415 (22.78/ 9.54)	PYTDPPSYPGThP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.78|      16|      16|      89|     104|       2
---------------------------------------------------------------------------
   76-   91 (27.77/16.05)	IQPSKVYNRTPYVTAT
   92-  107 (29.00/17.07)	IQPYTTRNMTNTRTKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.81|      10|      16|      13|      22|       3
---------------------------------------------------------------------------
   13-   22 (18.65/14.58)	HTVDPITAAN
   29-   38 (19.16/15.23)	HSVRPVEAMN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.08|      15|      16|     461|     476|       5
---------------------------------------------------------------------------
  461-  476 (19.92/22.99)	SHRESLISSIDATkLQ
  480-  494 (26.16/23.31)	SLADTRIYEVDQC.LQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.97|      16|      19|     675|     690|       6
---------------------------------------------------------------------------
  679-  697 (24.12/12.85)	NNLLLRCG.FDFTheeRSIG
  700-  716 (22.85/11.79)	KQMLLQKGiFALT...TPLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.67|      16|      18|     551|     566|       9
---------------------------------------------------------------------------
  551-  566 (27.28/19.42)	SLLSSDDLVSV...VFEWA
  569-  587 (22.39/14.44)	SLRSGQYRVYLaveIFKLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     249.02|      81|     110|    1138|    1228|      10
---------------------------------------------------------------------------
 1138- 1226 (126.81/117.22)	LLMLIDYLLAdpegggeADSHVQVARLLDLADDFsIRICKL..KLQIILTQEAKDAKDGKMRNRNVNPGNAPGNTAGGGNTTITGN................ATGGG
 1252- 1350 (122.21/85.02)	LLSVLDHHCA.......AEIRQDVEELFWDEENF.LRTKNLgaRLEVQMGEGTGDAIARAFLAVVEATGGATGGVGGGANVVSSANssnlssgangassgtgASGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     182.67|      42|     110|     840|     897|      11
---------------------------------------------------------------------------
  840-  881 (71.47/39.40)	HQLQTSKEFLISLLDLFTLAGLDGPIKNELSNHLSTYDQRHP
  951-  989 (65.93/35.00)	HLLSASKGLL..KLREFNPETFDDLSRRWIS.RMDNYSNRLP
 1025- 1056 (45.27/35.22)	SALDAG.LFLTHTLSLL.LCA..DPFSTPLSAA.SSY.....
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32938 with Med12 domain of Kingdom Fungi
Unable to open file!