<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32937

Description Similar to Serine/threonine-protein kinase SSN3 acc. no. Q6CCB0
SequenceMLHHPAPTHPPPPPQPPPPPLPIPPPSSLTTTTTPPLPNPSIALQALQQQNSEPTLLLPTSSAPDTVRRPTKRLNEDIETSSNSDPQEDTVVATTQLADREREKMPPYQSKVKVLEKYHIIGFISSGTYGRVYKAKSKIAGNKGEYAIKKFKPDKEGEVIQYTGISQSACREMALCSELSHENIIHFHEIILEDKCIYMVFEYAEHDLLQIIHYHSHTPDRRPIPEATVKSVLWQLLNGISYLHQNWVLHRDLKPANIMVTAAGEVKIGDLGLARLFYKPLQSLYTGDKVVVTIWYRAPELLLGSKHYTTAIDTWAVGCIFAELLALRPIFKGEEAKMEKKSTLPFQRNQMAKIIEILGTPTKERWPEVAQNPEYNQLASFKQYNNNLEVWYNSIGQKNKHGLNLLQGLLEYDPTRRLSAQQALEHPYFHEAAKLSLKYAFPSRCISFVGPSGLIP
Length456
PositionKinase
OrganismPyronema omphalodes (strain CBS 100304) (Pyronema confluens)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes> Pezizales> Pyronemataceae> Pyronema.
Aromaticity0.08
Grand average of hydropathy-0.424
Instability index50.91
Isoelectric point8.37
Molecular weight51498.51
Publications
PubMed=24068976

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32937
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.26|      15|      21|      58|      72|       4
---------------------------------------------------------------------------
   58-   72 (28.17/19.60)	LPTSSA..P..DTVRRPTK
   78-   96 (17.09/ 9.06)	IETSSNsdPqeDTVVATTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.54|      13|      14|     129|     142|       5
---------------------------------------------------------------------------
  129-  142 (17.71/15.61)	YGrVYKAKSKIAGN
  146-  158 (22.83/14.54)	YA.IKKFKPDKEGE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32937 with CDK8 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MLHHPAPTHPPPPPQPPPPPLPIPPPSSLTTTTTPPLPNPSIALQALQQQNSEPTLLLPTSSAPDTVRRPTKRLNEDIETSSNSDPQEDTVVATTQLADREREKMP
1
106










Molecular Recognition Features






MoRF SequenceStartStop




NANANA