<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32935
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MDIVLSPPNLSPDPTHPHSAASKALESLSSIDTDISLLLSSASSAIRCLTNSADPAVGAEGTPNPTNPSPAAPTGTPEERFTHHTEAYHKLLSSITVRLRRQILALQAAEIPVGIDVGTWNARNDVVGREMERELWEEAKGVVEAWAKGEEGWGGQGGVEGAMGEGQGAQGGEEMVIDG |
| Length | 179 |
| Position | Head |
| Organism | Pyronema omphalodes (strain CBS 100304) (Pyronema confluens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes>
Pezizales> Pyronemataceae> Pyronema.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.349 |
| Instability index | 40.76 |
| Isoelectric point | 4.61 |
| Molecular weight | 18742.54 |
| Publications | PubMed=24068976
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32935
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.35| 15| 15| 141| 155| 1
---------------------------------------------------------------------------
141- 155 (30.39/14.73) GVVE.AWAKGEEGWGG
157- 172 (22.96/ 9.71) GGVEgAMGEGQGAQGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 120.21| 36| 50| 12| 47| 2
---------------------------------------------------------------------------
12- 47 (59.66/33.96) PDPTHPHSAASKAL..ESLSSIDTDISLLLSSASSAIR
63- 100 (60.55/34.56) PNPTNPSPAAPTGTpeERFTHHTEAYHKLLSSITVRLR
---------------------------------------------------------------------------
|