<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32934

Description Similar to High-affinity methionine permease acc. no. P50276
SequenceMEGAFMDLRREETQKTTGEPEVTEGVTVADRNVFNQTSDARRQLGVFSAIFLIFNRMVGTGIFATPSTILAMSGSVGLSLFLWVAGTFISATGMAVYLEFGTAIPRNGGEKNYLEYVYKSPKFLVSAMFASYVFLLGWAGSNSVVFGEYILHAAGVEVDRWNQRGIGVACLTAAFLIHGTALNWGIRVQNFLGSIKLLIILLIIVSGWACLGGAVKLPEKPHNFENAFEGTTGSAYGVVNALYNVMWSFVGYSNANYALSETKNPVRTLKIAAPTALILVGILYMLVNIAYFSAVPKDEILTSGRILAASFFRNVFGHAAEKALSVFVALSAFGNVLSVIFSQGRIVQELGREGILPASAFFASNWPFNAPLAGLFEHWIVSVIIVLAPPPGDAYNFILNVITYPLSVVNFFVSAGLIYIYFNRSKFPDYNPAIKATLPVVVIFTLANVYLVVAPFVPPEQGQSVYKTLPYWLHCVVGIAFLVAGAFYWVVWAVLLPKMGGYTLIRQTVIQEDGWSRNVFSREYIKSTSILLDHYTIIIMDNPQKSLESTRIRLQQLVQTIDSFRASLARRPPHELPPWDQLQNHFNVLSSSLDSLSSNLHTHFPAHGTTGLDAYPLANYPVRTQTVLLDTLLSKKPPAETFDAVWEALKAPPLGQGIEELWGKAAEIVRGIQEERSWEDEVVTMEEREEGTVREEDWVLGGEEGEGMEERRRRLEREMNALTGVLRFCATGVPIMEQPPLPKKR
Length745
PositionHead
OrganismPyronema omphalodes (strain CBS 100304) (Pyronema confluens)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes> Pezizales> Pyronemataceae> Pyronema.
Aromaticity0.12
Grand average of hydropathy0.216
Instability index40.16
Isoelectric point6.03
Molecular weight82472.13
Publications
PubMed=24068976

Function

Annotated function 
GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
transmembrane transporter activity	GO:0022857	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32934
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.75|      15|      15|      45|      59|       2
---------------------------------------------------------------------------
   29-   48 (17.92/ 8.59)	ADRNVFNQTSDarrqlGVFS
   49-   64 (20.83/11.13)	AIFLIFNRMVG....tGIFA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.58|      15|      16|     370|     384|       3
---------------------------------------------------------------------------
  370-  384 (27.84/14.92)	APLAGLFEHWIVSVI
  388-  402 (28.74/15.62)	APPPGDAYNFILNVI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.31|      16|      68|     568|     583|       4
---------------------------------------------------------------------------
  568-  583 (32.66/19.99)	LARRPPHEL..PPWDQLQ
  633-  650 (23.65/12.51)	LSKKPPAETfdAVWEALK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.20|      14|      15|      93|     106|       6
---------------------------------------------------------------------------
   93-  106 (25.45/17.88)	GMAVYLEFGTAIPR
  109-  122 (25.75/18.19)	GEKNYLEYVYKSPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.63|      15|      19|     222|     236|       7
---------------------------------------------------------------------------
  222-  236 (27.22/14.99)	HNFENAFEGTTGSAY
  243-  257 (29.41/16.73)	YNVMWSFVGYSNANY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     173.69|      52|     202|     276|     327|      10
---------------------------------------------------------------------------
  276-  327 (85.67/49.74)	ALILVGILYMLVNIAYFSAVPKDEILTSGRILAASFFRNVFGHAAEKALSVF
  480-  531 (88.02/51.29)	AFLVAGAFYWVVWAVLLPKMGGYTLIRQTVIQEDGWSRNVFSREYIKSTSIL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32934 with Med8 domain of Kingdom Fungi
Unable to open file!