<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32932

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMSAPMEMYDPMDVTPPPASQPPTSQPLAVASSPGANTATSNPEMEFHDDLFGDNSDKLNALRLSTRLDELRRNGCNQRVAWSKLGCIALIDAAGTGVETRHLACNPEDGKWLLSDAYRINGVAKHHDEQKLQHLEWSSHGADLAVVDVLGNVSFFTVHVAINTLTFMTILKQPDNDDDSNALAGFWWLPAERPFALHSATKLEGRRYHYQTLSFRSFGPFHPVQNKGAAIGVTGNGTVKLWYHDGIMTYKQVSSELESLTTLNDIFTHASMSWTWGPEASAILAVYTHSRQLRVYKLQIKWNILPPNPPQPQGAPPVKPTTITTPPTLVIQRIKIIDSVLPLDCPQDPSRLHLTHLEVLSPMVGNPGAQLSPSTVLCVFSGKHPEGNLFSVVSRWDLKDTPSSSHPSFEQLNMRRASISSPVSAELDIHRLEEVMLDKCVIRVSSVMMGTIVSFASSDGTFEFRDRNHLQPFPATSLDKITGIFQSDFSFTENGDCLELILSPNNAVAVRLNYDHELIMQVMSYTRGPVSEAPHMEIACVSLATQHAYSCSNYLNNDDLLLVARKYQSKAFNSFFLTEVHKALALKMDFAVSESPSERLVRNPLLQRCLSLQFALDFQGENTPANLPGKLAWSTLHLRVASLAFGLTWNSAQRHQTNRLSAGEEFKISEALESLKGLVRWFMDMQAFIVSDLFDLAKECQGRTTDLAFVREKMVESNSPALLLLLASSPRAFMRYNCRSLRGLESITNKPMPGEDPQSQAEATSFRLPIDLSPIRLGRFEKMLTDIDGTIRAAYQEIKEPDRIIAERDLFVKTEIPAVFAGSVDRILGELVKGMKNDVELAKLFFKDTSWLGMSDDIMSRMYRKKTMIDAVRKTEIKPDGGKVLRLRRCTRCCSIVEEAVMSKTTDAVRAWERILGMDRIKVEEETEEEKFWEEMRRRNRDAVYRMREMEMGRNVGGAQE
Length960
PositionTail
OrganismPyronema omphalodes (strain CBS 100304) (Pyronema confluens)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes> Pezizales> Pyronemataceae> Pyronema.
Aromaticity0.08
Grand average of hydropathy-0.283
Instability index46.96
Isoelectric point6.13
Molecular weight107703.84
Publications
PubMed=24068976

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364149
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32932
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.55|      24|      75|     109|     140|       2
---------------------------------------------------------------------------
  111-  134 (45.42/42.98)	WL......LSDAYR....INGVAK...HHDEQKLQHL
  850-  886 (28.13/ 6.30)	WLgmsddiMSRMYRkktmIDAVRKteiKPDGGKVLRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.40|      13|      15|     358|     370|       3
---------------------------------------------------------------------------
  358-  370 (23.77/12.16)	VLSPMVG.NPGAQL
  375-  388 (20.64/ 9.71)	VLCVFSGkHPEGNL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.30|      16|      74|     389|     404|       4
---------------------------------------------------------------------------
  389-  404 (26.71/15.25)	FSVVSRWDLKDTPSSS
  405-  420 (26.59/15.15)	HPSFEQLNMRRASISS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32932 with Med16 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MSAPMEMYDPMDVTPPPASQPPTSQPLAVASSPGANTATSNPEMEFHDDLF
1
51










Molecular Recognition Features






MoRF SequenceStartStop




NANANA