| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTTYNPSQSQKNNSPPAPLDQPTPQSPSTYMFNGHGSSMDNNSYSQSIPDSLTPRPIQTATPISNPAAPNSAHEDSFMDDYVDSNPLKRRRTDGSFDAERRPAPPNRPSARNGSDRASPSMQQIQELISNPSCPPYRLVCSQSHEKAYPDPEENLLQLYNLNAVVDKVARYDPVTNRKNKLRKSYKGFIGGISGRHEVVAKPSKPDQQFFDNTDLVENKLQWLSFYPEDEWRNQCVLGKELSRGLDLGKLKRGLSGITKGDIPGFDASVLGLEDEPPKKRVDTARPSPAVGTPHQMNGSTPGAASNVSASGGANGTLNRPKRLEKRRLYGDKHYEGYAELDDEGDDSGWDAERKKKKKRKKAGPDECRRPMLIPLSMEWLSTRSTVTVSRAA |
| Length | 392 |
| Position | Head |
| Organism | Pyronema omphalodes (strain CBS 100304) (Pyronema confluens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes> Pezizales> Pyronemataceae> Pyronema. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.006 |
| Instability index | 56.12 |
| Isoelectric point | 9.03 |
| Molecular weight | 43425.80 |
| Publications | PubMed=24068976 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP32929
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 159.98| 36| 36| 38| 73| 1
---------------------------------------------------------------------------
1- 35 (54.64/22.10) ..MTTYNPSQSQKNNSPPAPLDQPTPQ.SPSTYMF..NGH
38- 73 (66.29/28.18) S.MDNNSYSQSIPDSLTPRPIQTATPI.SNPAAPN..SAH
76- 111 (39.06/13.96) SfMD.D.YVDSNP..LKRRRTDGSFDAeRRPAPPNrpSAR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) CRRPMLIPLS 2) GYAEL 3) WDAERKKKKKRKKAG | 367 336 349 | 376 340 363 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab