| Description | Similar to Mediator of RNA polymerase II transcription subunit 21 acc. no. Q7S8C2 |
| Sequence | MTDRLTQLQDAVDQLTTQFFSALRYVGNKHESAPVGNEDRVPDDKHHPDKPAVFEAALSELARDIIVKSKQIEVLITSLPGIGVSEEEQKNRLLNLEQQLKEAEAERLKAVEEKELARERLESVIVNLRRI |
| Length | 131 |
| Position | Middle |
| Organism | Pyronema omphalodes (strain CBS 100304) (Pyronema confluens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes> Pezizales> Pyronemataceae> Pyronema. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.566 |
| Instability index | 40.62 |
| Isoelectric point | 5.16 |
| Molecular weight | 14895.68 |
| Publications | PubMed=24068976 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP32927 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) APVGNEDRVPDDKHH 2) KPAVFEA 3) LARDIIVK 4) RLLNLE | 33 50 61 92 | 47 56 68 97 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab