<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32926
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MADIPRPRTPLDETTWRYPQFISNFGPLNENLVMHYFYESSFYDPTSSNGQLMAQINRNPAAAAKITSNHDFFEALKKFRGTEYILTVANNEAGIFVIRKQIRKAPRDVNVNGRMQKVEDVSVVQDYFIVGENIYQAPLVGAVVQNRLLTITRDLRETLKLAMEATSKAAEEAAIATTTASATPATSQQPGTQPQTAVGTPTPGGQQPGAQQLPQKTQSRKQMDEMLLRTSLELSAKFGDEFMDDHAPLLDNPGSMLATGAGIKGPSSAQDAMKRGSTPVPPRPQIGMKK |
| Length | 290 |
| Position | Head |
| Organism | Pyronema omphalodes (strain CBS 100304) (Pyronema confluens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes>
Pezizales> Pyronemataceae> Pyronema.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.487 |
| Instability index | 36.58 |
| Isoelectric point | 8.69 |
| Molecular weight | 31768.65 |
| Publications | PubMed=24068976
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32926
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.64| 17| 17| 179| 195| 1
---------------------------------------------------------------------------
165- 181 (21.85/ 8.27) ATSKAAEEAAIATTTAS
182- 198 (31.79/14.91) ATPATSQQPGTQPQTAV
---------------------------------------------------------------------------
|