<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32922
| Description |
Similar to RNA polymerase II holoenzyme cyclin-like subunit acc. no. Q0CV29 |
| Sequence | MAANYWTSSQRKHWTMTREKLAETRQNLDMADEKALATFPLPSYRHLSIFFHLQLVRLGRRMTARQQALATAQMYVRRFYTKVPIRDTNPFLVMATCLYLALKMEECPQHIRIVVSEARTCWPEAMPSFTEKLAECEFWVISELNSYLIVHHPYRTLQELSTPLALTTEENNTSWQIINDSCITDLPLIYPPHVISLTAIFLAVFMKPSPSGNNSNNHGAHGANMGNHSSHNSHNGHSSGHSSMASHNTLGGSSHGAGAALSSYAAGSGSQTSRMAKLIEWYAESKVDMEAIIDCVQEIMALYEVWEGFGMQQEKALKDIFVKMVKNPQPSQPQQQLLQRSG |
| Length | 342 |
| Position | Kinase |
| Organism | Pyronema omphalodes (strain CBS 100304) (Pyronema confluens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes>
Pezizales> Pyronemataceae> Pyronema.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.314 |
| Instability index | 52.79 |
| Isoelectric point | 7.27 |
| Molecular weight | 38501.48 |
| Publications | PubMed=24068976
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32922
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.95| 16| 111| 8| 23| 1
---------------------------------------------------------------------------
8- 23 (30.98/20.76) SSQRKHW..TMT..REKLAE
116- 135 (21.97/12.69) SEARTCWpeAMPsfTEKLAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.00| 15| 117| 197| 211| 3
---------------------------------------------------------------------------
197- 211 (26.64/18.14) LTAIFLAVFMKPSPS
317- 331 (27.36/18.81) LKDIFVKMVKNPQPS
---------------------------------------------------------------------------
|