<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32909
| Description |
Uncharacterized protein |
| Sequence | MPRISLFQQVGAQENQKYFTSLGTFSVRRSYAGPCTFSFCLSCLGTVMNSHSGAMSCAAVAVTALPVSLPLAGGPRLDTSYRPVRMPLGKLVQSRPPYSGVLPPGMGSMMGIDPSYKPAVYRQQPPVSQGQILRQQLQAKLQGQGIMGQQPVRQMAPTPSYGALQPSQGYTPYVSHIGLQQHPSQSGTMVPPTYSGQPYQNSHPSSNPALVDPVRQMQQRPSGYVHQQAPGYGHTLGNTQRFPHQSIQQTPMMSGMNHLGPQGVPSGIRPSQILPDQQQQQYLRQQQQQQMLRQQAAMRGTCHSPQ |
| Length | 306 |
| Position | Kinase |
| Organism | Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Muscicapidae> Ficedula.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.554 |
| Instability index | 72.28 |
| Isoelectric point | 10.11 |
| Molecular weight | 33393.71 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | beta-catenin binding GO:0008013 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32909
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 76.34| 15| 15| 84| 98| 1
---------------------------------------------------------------------------
67- 81 (25.07/ 8.96) VSLP.LAGGPRLDTSY
84- 98 (26.72/ 9.96) VRMP.LGKLVQSRPPY
101- 116 (24.55/ 8.64) VLPPgMGSMMGIDPSY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.56| 14| 20| 166| 184| 2
---------------------------------------------------------------------------
166- 184 (22.89/14.12) PsqgytPYVSHIGLQ.QHPS
191- 205 (23.68/ 6.15) P.....PTYSGQPYQnSHPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.55| 19| 66| 215| 233| 5
---------------------------------------------------------------------------
215- 233 (37.55/13.47) RQM...QQRPSGYVHQQAPGYG
279- 300 (25.99/ 7.20) QQQylrQQQQQQMLRQQAAMRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 52.15| 10| 22| 234| 243| 6
---------------------------------------------------------------------------
234- 243 (19.35/ 8.52) HTLGNTQRFP
258- 265 (16.49/ 6.20) H.LG.PQGVP
266- 275 (16.31/ 6.06) SGIRPSQILP
---------------------------------------------------------------------------
|