<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32906
| Description |
Cyclin dependent kinase 19 |
| Sequence | AESMLCFLPGSVLRLLVCYLIYLLLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTSDVFAGCQIPYPKREFLNEDEPEEKGDKNQQQQNQHQQQAAPQQQAQAAPQQPPQPQQQSSSQTNGTAAGAGAAAGAAAAGLQHSQDSGLNQVPPNKKPRIGPSGANSGGPVMPSDYQHSSSRLSYQSNIQGSSQSQSTMGYSTSSQQSSQYHQSHQSHRY |
| Length | 458 |
| Position | Kinase |
| Organism | Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Muscicapidae> Ficedula.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.581 |
| Instability index | 59.95 |
| Isoelectric point | 8.74 |
| Molecular weight | 51863.25 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32906
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.42| 13| 17| 328| 342| 1
---------------------------------------------------------------------------
328- 340 (25.46/13.97) QQQNQHQQQAAPQ
348- 360 (25.96/ 8.18) QQPPQPQQQSSSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 41| 106| 120| 2
---------------------------------------------------------------------------
106- 120 (26.77/22.57) DLKPANILVMGEGPE
144- 158 (28.67/24.75) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.64| 27| 40| 232| 264| 3
---------------------------------------------------------------------------
232- 264 (37.66/37.93) PTlqkdfRRTTYANSSLIKYMEKHKVkPDSKVF
275- 301 (48.98/30.36) PT.....KRITSEQALQDPYFQEDPL.PTSDVF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.97| 18| 32| 369| 399| 4
---------------------------------------------------------------------------
369- 387 (26.76/36.61) GAAAGAA..AAGLQHSQdSGL
402- 421 (30.20/ 9.01) GANSGGPvmPSDYQHSS.SRL
---------------------------------------------------------------------------
|