<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32904
Description |
Transcription elongation factor A2 |
Sequence | AMGGEDEIVRIARRLDKMVAKKNAEGAMDLLKELKSMPMTLDLLQSTRIGMSVNALRKQSTDEEVISLAKSLIKSWKKLLDASEEKNEEKKKSLSLPTSSSRDTGNSRDQSSNKRQEPPKTPTTPKITTFPPAPITCDAVRNKCREMLTAALQADDDYIAIGADCEHIAAQIEEYILADVKNTDMKYKNRVRSRISNLKDSKNPELKKNVLCGVIAPEQIAVMTSEEMASNELKEIRKAMTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWKVA |
Length | 301 |
Position | Unknown |
Organism | Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Muscicapidae> Ficedula.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.675 |
Instability index | 53.56 |
Isoelectric point | 8.92 |
Molecular weight | 33626.31 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | centrosome GO:0005813 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32904
No repeats found
|