<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32902
Description |
Cyclin C |
Sequence | MPFSRDRAGKRLTCRLGYHCRGSSLQWILDKQDLLKERQKDLKFLTEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
Length | 296 |
Position | Kinase |
Organism | Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Muscicapidae> Ficedula.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.204 |
Instability index | 48.81 |
Isoelectric point | 8.62 |
Molecular weight | 34700.12 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
identical protein binding GO:0042802 IEA:Ensembl
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32902
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 13| 24| 228| 241| 1
---------------------------------------------------------------------------
228- 241 (20.63/15.11) QW..FAELSvDMEKIL
253- 267 (20.73/10.63) QWknFDERK.EMATIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.90| 22| 147| 14| 35| 3
---------------------------------------------------------------------------
14- 35 (42.95/28.40) CRLGYHCRGSSLQWILD..KQDLL
162- 185 (37.95/24.31) CLIVYHPYRPLLQYVQDmgQEDML
---------------------------------------------------------------------------
|