Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | QCRFIFPDNLLGISWVDSSWIPILNNGSVLDYFSERSNPFYDRTCNNEVVKMQRMTLDHLNQMVGVEYILLHAQEPILFIIRKQQRQSPTQVMPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFEEAMSYCRYHPSKGYWWHFKDQEEREKTKPKAKKKEEPSSIFQRQRVDALLLDLRQKFPPRFVQQKPGEKPIPVDQIKKEPEPVPEAVKAEEKETVKNAQSAGAKGPPEKRMRLQ |
Length | 245 |
Position | Head |
Organism | Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Passeriformes> Muscicapidae> Ficedula. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.620 |
Instability index | 50.20 |
Isoelectric point | 8.98 |
Molecular weight | 28412.31 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl nucleoplasm GO:0005654 IEA:Ensembl |
GO - Biological Function | DNA binding GO:0003677 IEA:Ensembl transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro stem cell population maintenance GO:0019827 IEA:Ensembl |
Binary Interactions |
Repeats | >MDP32891 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 80.21| 23| 41| 148| 171| 1 --------------------------------------------------------------------------- 148- 170 (39.52/23.59) HFKDQEEREKTKPKAKKKEEPSS 191- 213 (40.69/20.20) RFVQQKPGEKPIPVDQIKKEPEP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IFQRQRVDALLLDLRQKFPPRFVQQ 2) KPIPVDQIKKEPEPVPEAVKAEEKETVKNAQSAGAKGPPEKRMRLQ | 171 200 | 195 245 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab