<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32879

Description WD repeat domain 1
SequencePLRWRQEHSVARCCPRMRKAPGDAQTASGRERAKMPYEIKKVFASLPQVERGVSKILGGDPKGNNFLYTNGKCVVIRNADNPAIADIYTEHAHQVVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDLAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQTRPYRLATGSDDNCAAFFEGPPFKFKFTLSDHTRFVNCVRFSPDGNRFATASADGQIFIYDGKTGEKVCALGGGKAHDGGIYAISWSPDSSQLLSASGDKTAKIWDVGANSVVNTFNMGSNVLDQQLGCLWQKDHLLTISLSGYINYLDKNNPNKPLRVIKGHSKSIQCLTVHKNGGKSYIYSGSNDGHINILGENDGFSGKGHTNQVSRMAVDEMDQLVTCSMDDTVRYTNLSKRDYSGQDAVKMDVQPKCLAVGPGGYTVVLCIGQIVLMKDKKKCFAIDDLGYEPEAVAVHPGGGTVAVGGTDGNVRLYSIQGTSLKSDDKSLEAKGPVTDLAYSHDGAFLAVCDANKVVTVFSVTDGYAEHNVFYGHHAKIVCIAWSPDNEHFASGGMDMMVYVWTVGDPETRVKIPDAHRLHHVSGLAWLDEHTLVTTSHDASVKAWSISY
Length636
PositionTail
OrganismAnas platyrhynchos platyrhynchos (Northern mallard)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae> Anatinae> Anas.
Aromaticity0.09
Grand average of hydropathy-0.328
Instability index20.34
Isoelectric point7.48
Molecular weight69397.50
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32879
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     189.71|      41|      42|     317|     357|       1
---------------------------------------------------------------------------
   91-  120 (25.66/ 8.40)	.......HAHQV.VV.AKY.....APS..GFYIASGDvsGKLRI..WD......
  260-  291 (35.99/14.07)	ALGGGKAHDGGI.YA.ISW.....SPDssQLLSASGD..KT.............
  317-  345 (38.39/15.38)	.............LG.CLW.....QKD..HLLTISLS..GYINY..LDKNNPNK
  346-  390 (52.46/23.10)	PLRVIKGHSKSI...qCLTvhkngGKS..YIYSGSND..GHINI..LGENDGFS
  391-  427 (37.23/14.75)	G....KGHTNQVsRM.AVD.....EMD..QLVTCSMD..DTVRYtnLSKRD...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.67|      10|      24|     441|     450|       2
---------------------------------------------------------------------------
  441-  450 (21.47/10.94)	KCLAVGPGGY
  467-  476 (19.19/ 9.05)	KCFAIDDLGY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     159.22|      38|      41|     530|     570|       3
---------------------------------------------------------------------------
  234-  258 (32.60/12.45)	DGNRFATASADGQIFIY...DGKTGEKV..........
  530-  567 (61.42/33.63)	DGAFLAVCDANKVVTVFSVTDGYAEHNVFYGHHAKIVC
  573-  610 (65.20/42.09)	DNEHFASGGMDMMVYVWTVGDPETRVKIPDAHRLHHVS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32879 with Med16 domain of Kingdom Metazoa
Unable to open file!