<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32877

Description Mediator complex subunit 27
SequenceMADGVLSPGVNLEAFSQAIAAIQALRSSVTRVFDCLKDGMRNKETLEGREKGFVAAFQESLHSVSRDLGELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVINRIDRMFPEMTIQLSRPNGASAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ
Length312
PositionTail
OrganismAnas platyrhynchos platyrhynchos (Northern mallard)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae> Anatinae> Anas.
Aromaticity0.08
Grand average of hydropathy-0.290
Instability index39.66
Isoelectric point9.37
Molecular weight35238.18
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
stem cell population maintenance	GO:0019827	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32877
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.95|      33|      34|     134|     167|       1
---------------------------------------------------------------------------
  134-  167 (50.89/37.04)	LKRSANQMGVSAKrRPKAQPTTLVLPPQYVDDVI
  170-  202 (54.07/34.68)	IDRMFPEMTIQLS.RPNGASAMLLVTLGKVLKVI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      84.96|      28|      34|       3|      31|       2
---------------------------------------------------------------------------
    3-   31 (41.49/32.07)	DGvLSPGVNLEAFSQA.IAAIQALRSSVTR
   38-   66 (43.47/28.90)	DG.MRNKETLEGREKGfVAAFQESLHSVSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      99.45|      30|      35|     235|     269|       3
---------------------------------------------------------------------------
  235-  269 (40.33/44.52)	SNYQVFQKVTDHaTTALLHYQLPqmPdvVVRSFMT
  273-  302 (59.13/41.03)	SYIKLFQAPCQR.CGKFLQDGLP..P..TWRDFRT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32877 with Med27 domain of Kingdom Metazoa
Unable to open file!