<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32873
Description |
Uncharacterized protein |
Sequence | FSTPKTELRGSGRAHSAPGAFSGAQAQAQAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTGTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLIPYVEEDGSKHDDRGAASQLRFASEERREIMEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
Length | 186 |
Position | Head |
Organism | Anas platyrhynchos platyrhynchos (Northern mallard) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae>
Anatinae> Anas.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.596 |
Instability index | 40.66 |
Isoelectric point | 9.05 |
Molecular weight | 21256.03 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
|
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP32873
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.25| 21| 71| 83| 103| 1
---------------------------------------------------------------------------
83- 103 (35.37/19.36) KLQEHLRQLSILFRKLR.LVYD
156- 177 (32.88/17.63) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|