<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32872

Description Cyclin dependent kinase 19
SequenceTGLSVSLQLLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTSDVFAGCQIPYPKREFLNEDEPEEKGDKEDLAYLLLHNENTLRSQQSTRSHPNIPMKIQSSESSTGTALVIGACLXGAGAGLQHSQDSSLNQVPPNKKPRIGPSGANSGGPVMPSDYQHSSSRLSYQSNIQGSSQSQSTMGYSTSSQQSSQYHQSHQSHRY
Length443
PositionKinase
OrganismAnas platyrhynchos platyrhynchos (Northern mallard)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae> Anatinae> Anas.
Aromaticity0.09
Grand average of hydropathy-0.548
Instability index61.42
Isoelectric point8.63
Molecular weight50286.60
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32872
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.75|      19|      40|     326|     348|       1
---------------------------------------------------------------------------
  335-  374 (15.85/ 9.15)	NIPmkiQSSESSTGtalvigaclxgagaglqhSQDSSLNQ
  411-  435 (28.90/ 9.15)	NIQ...GSSQSQST............mgystsSQQSSQYH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.64|      27|      40|     217|     249|       2
---------------------------------------------------------------------------
  217-  249 (37.66/33.76)	PTlqkdfRRTTYANSSLIKYMEKHKVkPDSKVF
  260-  286 (48.98/27.03)	PT.....KRITSEQALQDPYFQEDPL.PTSDVF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.44|      15|      37|      91|     105|       3
---------------------------------------------------------------------------
   91-  105 (26.77/16.67)	DLKPANILVMGEGPE
  129-  143 (28.67/18.30)	DLDPVVVTFWYRAPE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32872 with CDK8 domain of Kingdom Metazoa
Unable to open file!