<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32867
| Description |
Transcription elongation factor A2 |
| Sequence | MLGSLEDILRKAEALTLSISFPLQDGAMDLLKELKGMPMTLDLLQSTRIGMSVNALRKQSTDEEVIALAKSLIKSWKKLLDASEEKSEEKKKNLSLPTSSSKDTGNSKDQSSNKRQEPPKTPTTPKITTFPPAPVTCDAVRNKCREMLTTALQADDDYVAIGADCEHIAAQIEEYILADIKNTDMKYKNRVRSRISNLKDSKNPELKKNVLCGAITPEQIAVMTSEEMASNELKEIRKAMTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWKVA |
| Length | 301 |
| Position | Unknown |
| Organism | Anas platyrhynchos platyrhynchos (Northern mallard) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae>
Anatinae> Anas.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.608 |
| Instability index | 52.31 |
| Isoelectric point | 8.60 |
| Molecular weight | 33502.17 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | centrosome GO:0005813 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32867
No repeats found
No repeats found
|