<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32864
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | THSFPFRELIEILAISRNQKLPQPGEESQILELLIQRDGEFQELMKLAVEQGKIHHEMQLLEKVVEKRDNDIQQLQKQLKEAEHILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSSDMSMNMLPPNHSNDFMLEPPGHNKENEDDVEVMST |
Length | 225 |
Position | Middle |
Organism | Anas platyrhynchos platyrhynchos (Northern mallard) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae>
Anatinae> Anas.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.618 |
Instability index | 54.24 |
Isoelectric point | 5.40 |
Molecular weight | 25330.50 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
|
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
transcription by RNA polymerase II GO:0006366 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP32864
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.93| 30| 32| 36| 67| 1
---------------------------------------------------------------------------
37- 66 (51.75/28.79) RDGEFQELMKLAVEQGKIHHE..MQLLEKV..VE
68- 101 (36.18/17.74) RDNDIQQLQKQLKEAEHILATavYQAKEKLksIE
---------------------------------------------------------------------------
|