<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32862
| Description |
Cyclin C |
| Sequence | LQWILDKQDLLKERQKDLKFLTEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVCKFSFCLILFPMRCSQILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMASILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
| Length | 269 |
| Position | Kinase |
| Organism | Anas platyrhynchos platyrhynchos (Northern mallard) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae>
Anatinae> Anas.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.023 |
| Instability index | 47.78 |
| Isoelectric point | 6.39 |
| Molecular weight | 31439.54 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
identical protein binding GO:0042802 IEA:Ensembl
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32862
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.46| 15| 23| 44| 65| 2
---------------------------------------------------------------------------
44- 58 (24.39/27.99) LKLRQQVIATAT.VYF
67- 82 (21.07/ 6.17) LKSIDPVLMAPTcVFL
---------------------------------------------------------------------------
|