<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32860
Description |
Mediator of RNA polymerase II transcription subunit 16 |
Sequence | ADAVRREYCMVTGYDWWDILLHVQPNMVQNLVEKLHEEYMRQSAALQQVLSTRIVAMKASLCKLSSSTIARVCDYHAKLFLIAISCTLKSLLRPHFLNTPDKSPGDRLTEICSKITDIDIDKVMINLKTEEFVLEMTTLQSLQQLIQWVGDFVLYLLASLPNQGSPVRPGHSFLRDGASLGMFRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWLCCREENHITEPDDTLIDECCLLPSQLLIPNIDWLPINDGIISKLQNKQLVRLQFGKAPGLVGHTLPFFFLSRAPGQPKIDHLRRLHLGAYPTEECKSYAEEVLAETQ |
Length | 333 |
Position | Tail |
Organism | Anas platyrhynchos platyrhynchos (Northern mallard) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Anseriformes> Anatidae>
Anatinae> Anas.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.023 |
Instability index | 55.80 |
Isoelectric point | 6.16 |
Molecular weight | 37853.77 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
|
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP32860
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 359.62| 109| 136| 15| 126| 1
---------------------------------------------------------------------------
15- 126 (172.95/108.60) DWWDILLHVQPNMvQNLVEKLHeEYMRQSAAL....QQVLSTRIVAMKASLCKLSSSTIARVCDYHAKLFLIAISCTLKSLLRPHfLNTPDKSPGDRLTEICSKITDIDIDKVMIN
151- 263 (186.67/105.63) DFVLYLLASLPNQ.GSPVRPGH.SFLRDGASLgmfrELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWLCCREENH.ITEPDDTLIDECCLLPSQLLIPNIDWLPIN
---------------------------------------------------------------------------
|